PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10019799m
Common NameEUTSA_v10019799mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family ARR-B
Protein Properties Length: 875aa    MW: 97421.9 Da    PI: 4.4632
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10019799mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like41.43.1e-13237286555
          G2-like   5 rWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      +Wt++   +F+ a++ L G++   Pk+il +m+  +L l +v SHLQkY+ 
  Thhalv10019799m 237 VWTQDRQMKFLTAISIL-GEKDSRPKSILSIMNDSDLNLRQVGSHLQKYKA 286
                      6****************.9999***************************85 PP

2Response_reg42.14.8e-15231291109
                      EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH.ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTT CS
     Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd.pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaG 93 
                      vl++d + +    l+++l++  y +v ++  ++eal ++++++ ++l++  iemp++d + +l+ +  +e  +p i+++ + +++ a + l   
  Thhalv10019799m  23 VLLIDNDTISIGSLTSMLKQFSY-KVVSVNMASEALSMIEKQKdIGLVIANIEMPHIDSHSFLTALLHKE--IPLILISPEMDNKEASDLLTKS 113
                      89*********************.9**************77666**********************7766..9********************* PP

                      ESEEEESS--HHHHHH CS
     Response_reg  94 akdflsKpfdpeelvk 109
                      a+ +l Kp++++++ +
  Thhalv10019799m 114 AHFCLKKPISENDIKN 129
                      ***********99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521725.41E-1720152IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.3E-1921155No hitNo description
SMARTSM004481.0E-421131IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011026.9522135IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.2E-1223129IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.88E-1124134No hitNo description
SuperFamilySSF466896.81E-9234287IPR009057Homeodomain-like
TIGRFAMsTIGR015577.8E-13237286IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.4E-14237288IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 875 aa     Download sequence    Send to blast
MTEKLSVNLA GNTVPERIGD ISVLLIDNDT ISIGSLTSML KQFSYKVVSV NMASEALSMI  60
EKQKDIGLVI ANIEMPHIDS HSFLTALLHK EIPLILISPE MDNKEASDLL TKSAHFCLKK  120
PISENDIKNL WQHVVPKKSQ ELEKINITEQ QEKVVEKSIL NQIESFRETI KRQRTSQSSL  180
LGRRPFVKTF TTPETYQKRN GKAINEGKTK PVYPTEAAKK RGEGIKMESN VGRRCNVWTQ  240
DRQMKFLTAI SILGEKDSRP KSILSIMNDS DLNLRQVGSH LQKYKAQVEL MNDSLSKNEW  300
RSTDKTFNYP SDYEYPFNAS NLAKNIVKSN TKWYSLKKKE ASSSSIDQYS FKKSAGKEKA  360
RMMPKFHLGG KLDLSKHSFF DNMLNKSPME AKSPSATSNN PPSHISSTNY VNNSVLSSDN  420
PPVLSGLPSS VGASNYSGLS DNPLVLAGLP SIVSASNHSG LSSDNPPVLS GLPSSVGASN  480
HSGLSDNSLI ISGLPSSVSA SNTDALQICT PHSEPNPFQP SSSVLEFDWN QLDLDSIYIP  540
EAYVPQADLF TMGESYFLPD LDVTMNPLET NMDMIDWIPS TDNISDHETN MNQMGWAPST  600
ENISLPETNM NQMDWIPTIE KYVLPQTDMN INVPETNTTH MGWVSSGEGY VASENMIPSE  660
ISNQMGRVSS GENHVLPQDI ISSVSFASGQ TSYENPSQTN TTTILETNTD QMDWLFSEES  720
FLLLEDMPSF ETNTTQSLEI NMEDMGLVPY MEDNDVPIEE LISFDIDVNE MDIDYWLGNY  780
GSSEENIPLS TRYTRHDSAF NTLMDSTPHT TMEDHDQSLA MNLKSSSQQH NMMEPCGYQN  840
MGAENPREAM EGGVHFDDDP EDMSWIDEMI NDNA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006391168.10.0hypothetical protein EUTSA_v10019799mg
TrEMBLV4KBF20.0V4KBF2_EUTSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM136851424
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68210.10.0pseudo-response regulator 6